Free Shipping (US & Puerto Rico) for all orders over $300

4
$251.47

USA250 Discount Coupon will be applied automatically

Cagrilintide 10MG

Original price was: $99.99.Current price is: $50.00.

Lab-tested icon Lab-tested • 99%+ Purity
Ships to US & Puerto Rico icon Ships to US & Puerto Rico
Research Use Only icon RUO – Research Use Only

All vials are batch-tested in-house and third-party verified. Documents (COAs/HPLC) are available on request. These products are for in-vitro laboratory research only and are not intended for human or animal use.

In stock

  • Used in clinical trials involving humans.
  • Administered to humans as part of experiment or investigation.
  • Supplied to another party for human investigation use.

Cagrilintide Overview

Cagrilintide is a long-acting acylated peptide analog structurally related to the amylin hormone. It is studied for its interaction with amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). Current research investigates its role in receptor signaling, energy regulation, and satiety mechanisms in experimental settings. Cagrilintide is of growing interest in metabolic and neuroendocrine studies due to its dual receptor targeting and sustained receptor activity.

Product Details

  • Sequence: {Eicosanedioic acid-?-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge: Cys3-Cys8)
  • Sequence Shortening: {Eicosanedioic acid-?-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • CAS Number: 1415456-99-3

Research Highlights

  1. Receptor Interaction: Cagrilintide binds to amylin and calcitonin receptors, providing a dual-agonist profile of interest in metabolic and appetite regulation studies.
  2. Peptide Stability: Modified for extended half-life, allowing for long-acting receptor activation in pharmacological models.
  3. In Vivo Studies: Demonstrated measurable effects in animal trials evaluating food intake signaling and energy homeostasis via central nervous system pathways.
  4. Mechanistic Investigations: Utilized in experiments assessing receptor expression, ligand binding affinities, and downstream pathway activation related to neuroendocrine feedback loops.

Usage and Safety Information

This compound is intended for laboratory research use only. It is not approved for human consumption or non-research applications. Handle in accordance with institutional safety guidelines and proper laboratory protocols.
  • This product is sold for scientific research purposes only.
  • Product is provided as a lyophilized (freeze-dried) powder in a sealed, sterile vial.
  • The quantity on the label refers to the total amount of product inside each vial.
  • Additional lab supplies are required for conducting research such as bacteriostatic water for reconstitution, syringes & needles to draw from the vials, and alcohol prep pads for sanitizing vial stoppers prior to needle insertion.
  • Vial appearance, label, seal and cap colors may vary from product photos.
CAS Number2023788-19-2
PubChem CID156588324
Molecular Weight4813.527 g/mol
Molecular FormulaC225H348N48O68
SynonymsGTPL11429, P1206, LY3298176
Storage (Lyophilized)At 39 Fahrenheit: 2 years
At -4 Fahrenheit: 3 years

Related Products

Research Use Acknowledgment

I understand these products are for research use only and not for use in people or pets. I am purchasing these items for laboratory or research purposes only. They are not for human or animal use, not medicine, and not for diagnosing, treating, or curing any condition. I will follow all applicable laws and safe handling rules. I accept that Sigma Peptides, this website, and our affiliates are not responsible for how I use or store these items once delivered, to the fullest extent allowed by law.

Disclaimer: -Peptides: RESEARCH USE ONLY — NOT FOR HUMAN OR ANIMAL USE All products sold by this merchant are intended strictly for in-vitro laboratory, analytical, and scientific research purposes only. These products have not been evaluated or approved by the U.S. Food and Drug Administration and are not intended for human or veterinary use, human consumption, injection, diagnosis, treatment, cure, or prevention of any disease. By purchasing from this website, you confirm that you are a qualified researcher, are at least 21 years old, and will use the products only in compliance with all applicable laws and regulations. Merchant is not responsible for unauthorized, improper, or unlawful use of its products to the fullest extent permitted by law.  

4
Someone in purchased