Cagrilintide Overview

Cagrilintide is a long-acting acylated peptide analog structurally related to the amylin hormone. It is studied for its interaction with amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). Current research investigates its role in receptor signaling, energy regulation, and satiety mechanisms in experimental settings. Cagrilintide is of growing interest in metabolic and neuroendocrine studies due to its dual receptor targeting and sustained receptor activity.

Product Details

• Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge: Cys3-Cys8)
• Sequence Shortening: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
• Molecular Formula: C194H312N54O59S2
• Molecular Weight: 4409.01 g/mol
• CAS Number: 1415456-99-3

Research Highlights

1. Receptor Interaction: Cagrilintide binds to amylin and calcitonin receptors, providing a dual-agonist profile of interest in metabolic and appetite regulation studies.
2. Peptide Stability: Modified for extended half-life, allowing for long-acting receptor activation in pharmacological models.
3. In Vivo Studies: Demonstrated measurable effects in animal trials evaluating food intake signaling and energy homeostasis via central nervous system pathways.
4. Mechanistic Investigations: Utilized in experiments assessing receptor expression, ligand binding affinities, and downstream pathway activation related to neuroendocrine feedback loops.

Usage and Safety Information

This compound is intended for laboratory research use only. It is not approved for human consumption or therapeutic applications. Handle in accordance with institutional safety guidelines and proper laboratory protocols.