Free Shipping (US & Puerto Rico) for all orders over $300

Cagrilintide 10MG

$99.99

Lab-tested icon Lab-tested • 99%+ Purity
Ships to US & Puerto Rico icon Ships to US & Puerto Rico
Research Use Only icon RUO – Research Use Only

All vials are batch-tested in-house and third-party verified. Documents (COAs/HPLC) are available on request. These products are for in-vitro laboratory research only and are not intended for human or animal use.

🔬 Bulk Research Pricing

1 - 2 3 - 4 5 - 9 10 - 19 20 - 49 ⭐ 50+ ⭐
- - - - - -
1 - 2
-
3 - 4
-
5 - 9
-
10 - 19
-
20 - 49 ⭐
-
50+ ⭐
-

⭐ Mix & match different products at 20+ vials | Discounts apply automatically at checkout

In stock

  • Used in clinical trials involving humans.
  • Administered to humans as part of experiment or investigation.
  • Supplied to another party for human investigation use.

Cagrilintide Overview

Cagrilintide is a long-acting acylated peptide analog structurally related to the amylin hormone. It is studied for its interaction with amylin receptors (AMYR) and calcitonin G protein-coupled receptors (CTR). Current research investigates its role in receptor signaling, energy regulation, and satiety mechanisms in experimental settings. Cagrilintide is of growing interest in metabolic and neuroendocrine studies due to its dual receptor targeting and sustained receptor activity.

Product Details

  • Sequence: {Eicosanedioic acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge: Cys3-Cys8)
  • Sequence Shortening: {Eicosanedioic acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2
  • Molecular Formula: C194H312N54O59S2
  • Molecular Weight: 4409.01 g/mol
  • CAS Number: 1415456-99-3

Research Highlights

  1. Receptor Interaction: Cagrilintide binds to amylin and calcitonin receptors, providing a dual-agonist profile of interest in metabolic and appetite regulation studies.
  2. Peptide Stability: Modified for extended half-life, allowing for long-acting receptor activation in pharmacological models.
  3. In Vivo Studies: Demonstrated measurable effects in animal trials evaluating food intake signaling and energy homeostasis via central nervous system pathways.
  4. Mechanistic Investigations: Utilized in experiments assessing receptor expression, ligand binding affinities, and downstream pathway activation related to neuroendocrine feedback loops.

Usage and Safety Information

This compound is intended for laboratory research use only. It is not approved for human consumption or therapeutic applications. Handle in accordance with institutional safety guidelines and proper laboratory protocols.

  • This product is sold for scientific research purposes only.
  • Product is provided as a lyophilized (freeze-dried) powder in a sealed, sterile vial.
  • The quantity on the label refers to the total amount of product inside each vial.
  • Additional lab supplies are required for conducting research such as bacteriostatic water for reconstitution, syringes & needles to draw from the vials, and alcohol prep pads for sanitizing vial stoppers prior to needle insertion.
  • Vial appearance, label, seal and cap colors may vary from product photos.
CAS Number2023788-19-2
PubChem CID156588324
Molecular Weight4813.527 g/mol
Molecular FormulaC225H348N48O68
SynonymsGTPL11429, P1206, LY3298176
Storage (Lyophilized)At 39 Fahrenheit: 2 years
At -4 Fahrenheit: 3 years

Related Products

Current Offer

Welcome!

You must be 21+ to purchase Peptides products

I am I am not

Remember Me
Disclaimer: Peptides: This product is intended for laboratory research use only and is not approved for human consumption, medical, or veterinary use. Peptides are sold solely for research and development purposes by qualified professionals. Buyers are responsible for handling all materials in accordance with local regulations and safety guidelines. We respect federal state and city laws, our shipping restrictions are automatically updated by WAAVE compliance. No international shipping is allowed. 

WAAVE Compliance
0